Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3757497..3758117 | Replicon | chromosome |
| Accession | NZ_CP104643 | ||
| Organism | Salmonella enterica strain 1020677 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | N5930_RS18435 | Protein ID | WP_001280991.1 |
| Coordinates | 3757899..3758117 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | N5930_RS18430 | Protein ID | WP_000344807.1 |
| Coordinates | 3757497..3757871 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5930_RS18420 (3752636) | 3752636..3753829 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N5930_RS18425 (3753852) | 3753852..3757001 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| N5930_RS18430 (3757497) | 3757497..3757871 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| N5930_RS18435 (3757899) | 3757899..3758117 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| N5930_RS18440 (3758296) | 3758296..3758847 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| N5930_RS18445 (3758965) | 3758965..3759435 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| N5930_RS18450 (3759491) | 3759491..3759631 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| N5930_RS18455 (3759637) | 3759637..3759897 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| N5930_RS18460 (3760122) | 3760122..3761672 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| N5930_RS18470 (3761903) | 3761903..3762292 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| N5930_RS18475 (3762325) | 3762325..3762894 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258772 WP_001280991.1 NZ_CP104643:3757899-3758117 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258772 WP_000344807.1 NZ_CP104643:3757497-3757871 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|