Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1176975..1177635 | Replicon | chromosome |
Accession | NZ_CP104643 | ||
Organism | Salmonella enterica strain 1020677 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | N5930_RS05650 | Protein ID | WP_000244756.1 |
Coordinates | 1177222..1177635 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | N5930_RS05645 | Protein ID | WP_000351186.1 |
Coordinates | 1176975..1177241 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5930_RS05625 (1172904) | 1172904..1174337 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
N5930_RS05630 (1174495) | 1174495..1174806 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
N5930_RS05635 (1174970) | 1174970..1175629 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
N5930_RS05640 (1175745) | 1175745..1176725 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
N5930_RS05645 (1176975) | 1176975..1177241 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
N5930_RS05650 (1177222) | 1177222..1177635 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
N5930_RS05655 (1177688) | 1177688..1178209 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
N5930_RS05660 (1178322) | 1178322..1179218 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
N5930_RS05665 (1179242) | 1179242..1179955 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5930_RS05670 (1179961) | 1179961..1181694 | + | 1734 | WP_000813389.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T258764 WP_000244756.1 NZ_CP104643:1177222-1177635 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |