258762

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 662263..662849 Replicon chromosome
Accession NZ_CP104643
Organism Salmonella enterica strain 1020677

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag N5930_RS03100 Protein ID WP_000174964.1
Coordinates 662481..662849 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag N5930_RS03095 Protein ID WP_001522145.1
Coordinates 662263..662484 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5930_RS03070 (657284) 657284..658393 + 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
N5930_RS03075 (658453) 658453..659379 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N5930_RS03080 (659376) 659376..660653 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
N5930_RS03085 (660650) 660650..661417 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N5930_RS03090 (661419) 661419..662132 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N5930_RS03095 (662263) 662263..662484 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5930_RS03100 (662481) 662481..662849 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N5930_RS03105 (663108) 663108..664424 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N5930_RS03110 (664529) 664529..665416 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N5930_RS03115 (665413) 665413..666258 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N5930_RS03120 (666260) 666260..667330 + 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 659376..668067 8691
- inside Prophage - - 652043..668067 16024


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T258762 WP_000174964.1 NZ_CP104643:662481-662849 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT258762 WP_001522145.1 NZ_CP104643:662263-662484 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References