Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 662263..662849 | Replicon | chromosome |
| Accession | NZ_CP104643 | ||
| Organism | Salmonella enterica strain 1020677 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A3V9X0E4 |
| Locus tag | N5930_RS03100 | Protein ID | WP_000174964.1 |
| Coordinates | 662481..662849 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | V7IU48 |
| Locus tag | N5930_RS03095 | Protein ID | WP_001522145.1 |
| Coordinates | 662263..662484 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5930_RS03070 (657284) | 657284..658393 | + | 1110 | WP_000822978.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| N5930_RS03075 (658453) | 658453..659379 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| N5930_RS03080 (659376) | 659376..660653 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| N5930_RS03085 (660650) | 660650..661417 | + | 768 | WP_000082080.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| N5930_RS03090 (661419) | 661419..662132 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| N5930_RS03095 (662263) | 662263..662484 | + | 222 | WP_001522145.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N5930_RS03100 (662481) | 662481..662849 | + | 369 | WP_000174964.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N5930_RS03105 (663108) | 663108..664424 | + | 1317 | WP_000624755.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| N5930_RS03110 (664529) | 664529..665416 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| N5930_RS03115 (665413) | 665413..666258 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| N5930_RS03120 (666260) | 666260..667330 | + | 1071 | WP_000907840.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 659376..668067 | 8691 | |
| - | inside | Prophage | - | - | 652043..668067 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13601.91 Da Isoelectric Point: 6.7252
>T258762 WP_000174964.1 NZ_CP104643:662481-662849 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|