Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 552134..552894 | Replicon | chromosome |
Accession | NZ_CP104643 | ||
Organism | Salmonella enterica strain 1020677 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A1R2W0C7 |
Locus tag | N5930_RS02615 | Protein ID | WP_000533912.1 |
Coordinates | 552409..552894 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | N5930_RS02610 | Protein ID | WP_000965886.1 |
Coordinates | 552134..552421 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5930_RS02590 (547539) | 547539..548450 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
N5930_RS02595 (548460) | 548460..550529 | + | 2070 | WP_001291741.1 | glycine--tRNA ligase subunit beta | - |
N5930_RS02600 (550919) | 550919..551317 | + | 399 | Protein_491 | IS3 family transposase | - |
N5930_RS02605 (551489) | 551489..551956 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
N5930_RS02610 (552134) | 552134..552421 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
N5930_RS02615 (552409) | 552409..552894 | + | 486 | WP_000533912.1 | GNAT family N-acetyltransferase | Toxin |
N5930_RS02620 (553265) | 553265..553804 | - | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
N5930_RS02625 (553978) | 553978..554190 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
N5930_RS02630 (554478) | 554478..554768 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
N5930_RS02635 (555207) | 555207..555917 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
N5930_RS02640 (555967) | 555967..556941 | - | 975 | WP_000804678.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
N5930_RS02645 (557160) | 557160..557822 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17731.46 Da Isoelectric Point: 9.8719
>T258761 WP_000533912.1 NZ_CP104643:552409-552894 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1R2W0C7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |