Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 55029..55554 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104642 | ||
| Organism | Salmonella enterica strain 1019942 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | I3W3D5 |
| Locus tag | N5927_RS23370 | Protein ID | WP_001159863.1 |
| Coordinates | 55249..55554 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7S5D0 |
| Locus tag | N5927_RS23365 | Protein ID | WP_000813641.1 |
| Coordinates | 55029..55247 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5927_RS23335 (N5927_23340) | 50681..51067 | + | 387 | WP_000751876.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| N5927_RS23340 (N5927_23345) | 51120..51239 | + | 120 | Protein_65 | recombinase | - |
| N5927_RS23345 (N5927_23350) | 51570..52559 | - | 990 | WP_000461382.1 | RepB family plasmid replication initiator protein | - |
| N5927_RS23350 (N5927_23355) | 53053..53348 | - | 296 | Protein_67 | cytoplasmic protein | - |
| N5927_RS23355 (N5927_23360) | 53360..53788 | + | 429 | Protein_68 | hypothetical protein | - |
| N5927_RS23360 (N5927_23365) | 53832..54353 | - | 522 | WP_077681952.1 | hypothetical protein | - |
| N5927_RS23365 (N5927_23370) | 55029..55247 | + | 219 | WP_000813641.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| N5927_RS23370 (N5927_23375) | 55249..55554 | + | 306 | WP_001159863.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| N5927_RS23375 (N5927_23380) | 55556..55846 | + | 291 | WP_001266176.1 | hypothetical protein | - |
| N5927_RS23380 (N5927_23385) | 55843..56364 | + | 522 | WP_000198608.1 | hypothetical protein | - |
| N5927_RS23385 (N5927_23390) | 56399..57181 | + | 783 | WP_000082169.1 | site-specific integrase | - |
| N5927_RS23390 (N5927_23395) | 57190..57903 | + | 714 | WP_000545756.1 | EAL domain-containing protein | - |
| N5927_RS23395 (N5927_23400) | 57928..58416 | + | 489 | WP_001075507.1 | CaiF/GrlA family transcriptional regulator | - |
| N5927_RS23400 (N5927_23405) | 58410..58895 | + | 486 | WP_000905606.1 | membrane protein | - |
| N5927_RS23405 (N5927_23410) | 59142..59495 | + | 354 | Protein_78 | LysM peptidoglycan-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | fdeC / spvC / spvB / rck / pefD / pefC / pefA / pefB | 1..59573 | 59573 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11587.48 Da Isoelectric Point: 6.9787
>T258758 WP_001159863.1 NZ_CP104642:55249-55554 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | I3W3D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ICA6 |