Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 55029..55554 Replicon plasmid unnamed1
Accession NZ_CP104642
Organism Salmonella enterica strain 1019942

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag N5927_RS23370 Protein ID WP_001159863.1
Coordinates 55249..55554 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag N5927_RS23365 Protein ID WP_000813641.1
Coordinates 55029..55247 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5927_RS23335 (N5927_23340) 50681..51067 + 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -
N5927_RS23340 (N5927_23345) 51120..51239 + 120 Protein_65 recombinase -
N5927_RS23345 (N5927_23350) 51570..52559 - 990 WP_000461382.1 RepB family plasmid replication initiator protein -
N5927_RS23350 (N5927_23355) 53053..53348 - 296 Protein_67 cytoplasmic protein -
N5927_RS23355 (N5927_23360) 53360..53788 + 429 Protein_68 hypothetical protein -
N5927_RS23360 (N5927_23365) 53832..54353 - 522 WP_077681952.1 hypothetical protein -
N5927_RS23365 (N5927_23370) 55029..55247 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N5927_RS23370 (N5927_23375) 55249..55554 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
N5927_RS23375 (N5927_23380) 55556..55846 + 291 WP_001266176.1 hypothetical protein -
N5927_RS23380 (N5927_23385) 55843..56364 + 522 WP_000198608.1 hypothetical protein -
N5927_RS23385 (N5927_23390) 56399..57181 + 783 WP_000082169.1 site-specific integrase -
N5927_RS23390 (N5927_23395) 57190..57903 + 714 WP_000545756.1 EAL domain-containing protein -
N5927_RS23395 (N5927_23400) 57928..58416 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
N5927_RS23400 (N5927_23405) 58410..58895 + 486 WP_000905606.1 membrane protein -
N5927_RS23405 (N5927_23410) 59142..59495 + 354 Protein_78 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - fdeC / spvC / spvB / rck / pefD / pefC / pefA / pefB 1..59573 59573


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T258758 WP_001159863.1 NZ_CP104642:55249-55554 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT258758 WP_000813641.1 NZ_CP104642:55029-55247 [Salmonella enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References