Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4218641..4219422 | Replicon | chromosome |
| Accession | NZ_CP104641 | ||
| Organism | Salmonella enterica strain 1019942 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B5R980 |
| Locus tag | N5927_RS20725 | Protein ID | WP_000626100.1 |
| Coordinates | 4218641..4219132 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | N5927_RS20730 | Protein ID | WP_001110452.1 |
| Coordinates | 4219129..4219422 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5927_RS20690 (4214101) | 4214101..4214448 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
| N5927_RS20695 (4214424) | 4214424..4216127 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
| N5927_RS20700 (4216164) | 4216164..4216739 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| N5927_RS20710 (4217010) | 4217010..4217084 | - | 75 | Protein_4046 | helix-turn-helix domain-containing protein | - |
| N5927_RS20715 (4217464) | 4217464..4217541 | + | 78 | Protein_4047 | porin family protein | - |
| N5927_RS20720 (4217641) | 4217641..4218393 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
| N5927_RS20725 (4218641) | 4218641..4219132 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
| N5927_RS20730 (4219129) | 4219129..4219422 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| N5927_RS20735 (4219739) | 4219739..4219960 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| N5927_RS20740 (4220226) | 4220226..4221101 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
| N5927_RS20745 (4221098) | 4221098..4221385 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
| N5927_RS20750 (4221378) | 4221378..4221686 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
| N5927_RS20755 (4221685) | 4221685..4221933 | + | 249 | Protein_4055 | Ig-like domain-containing protein | - |
| N5927_RS20760 (4222045) | 4222045..4222176 | + | 132 | Protein_4056 | hypothetical protein | - |
| N5927_RS20765 (4222470) | 4222470..4223375 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T258755 WP_000626100.1 NZ_CP104641:c4219132-4218641 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656IQ80 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |