Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4070620..4071170 | Replicon | chromosome |
Accession | NZ_CP104641 | ||
Organism | Salmonella enterica strain 1019942 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | N5927_RS19940 | Protein ID | WP_001199743.1 |
Coordinates | 4070620..4070928 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7RP97 |
Locus tag | N5927_RS19945 | Protein ID | WP_001118105.1 |
Coordinates | 4070931..4071170 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5927_RS19920 (4067194) | 4067194..4067934 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
N5927_RS19925 (4068056) | 4068056..4068586 | - | 531 | WP_001708209.1 | SEF14 fimbria major subunit SefA | - |
N5927_RS19930 (4068909) | 4068909..4070042 | + | 1134 | Protein_3895 | IS3 family transposase | - |
N5927_RS19935 (4070074) | 4070074..4070214 | - | 141 | Protein_3896 | Arm DNA-binding domain-containing protein | - |
N5927_RS19940 (4070620) | 4070620..4070928 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
N5927_RS19945 (4070931) | 4070931..4071170 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
N5927_RS19950 (4071279) | 4071279..4071527 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
N5927_RS19955 (4071718) | 4071718..4072149 | - | 432 | Protein_3900 | helix-turn-helix domain-containing protein | - |
N5927_RS19965 (4072906) | 4072906..4073925 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
N5927_RS19970 (4073953) | 4073953..4074483 | - | 531 | WP_000896758.1 | gluconokinase | - |
N5927_RS19975 (4074700) | 4074700..4075731 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4069001..4072104 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T258753 WP_001199743.1 NZ_CP104641:c4070928-4070620 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H9SZK8 |