Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3405552..3406172 | Replicon | chromosome |
Accession | NZ_CP104641 | ||
Organism | Salmonella enterica strain 1019942 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N5927_RS16750 | Protein ID | WP_001280991.1 |
Coordinates | 3405954..3406172 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N5927_RS16745 | Protein ID | WP_000344807.1 |
Coordinates | 3405552..3405926 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5927_RS16735 (3400691) | 3400691..3401884 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N5927_RS16740 (3401907) | 3401907..3405056 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N5927_RS16745 (3405552) | 3405552..3405926 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N5927_RS16750 (3405954) | 3405954..3406172 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N5927_RS16755 (3406351) | 3406351..3406902 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
N5927_RS16760 (3407020) | 3407020..3407490 | + | 471 | WP_000136183.1 | YlaC family protein | - |
N5927_RS16765 (3407546) | 3407546..3407686 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N5927_RS16770 (3407692) | 3407692..3407952 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
N5927_RS16775 (3408177) | 3408177..3409727 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
N5927_RS16785 (3409958) | 3409958..3410347 | + | 390 | WP_000961287.1 | MGMT family protein | - |
N5927_RS16790 (3410380) | 3410380..3410949 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258749 WP_001280991.1 NZ_CP104641:3405954-3406172 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258749 WP_000344807.1 NZ_CP104641:3405552-3405926 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|