Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 64693..65252 Replicon plasmid unnamed1
Accession NZ_CP104640
Organism Escherichia coli strain PNUSAE014970

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag N4555_RS27305 Protein ID WP_000421248.1
Coordinates 64977..65252 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag N4555_RS27300 Protein ID WP_001178089.1
Coordinates 64693..64977 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4555_RS27260 (59885) 59885..60445 + 561 WP_000840472.1 fertility inhibition protein FinO -
N4555_RS27265 (60578) 60578..60790 + 213 WP_001302189.1 ANR family transcriptional regulator -
N4555_RS27270 (61035) 61035..61496 + 462 WP_001233853.1 thermonuclease family protein -
N4555_RS27275 (61542) 61542..61751 + 210 WP_001302200.1 hemolysin expression modulator Hha -
N4555_RS27280 (61789) 61789..62127 + 339 WP_000766796.1 hypothetical protein -
N4555_RS27285 (62367) 62367..62621 + 255 WP_000083831.1 replication regulatory protein RepA -
N4555_RS27290 (62857) 62857..62931 + 75 WP_001370046.1 RepA leader peptide Tap -
N4555_RS27295 (62924) 62924..63781 + 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
N4555_RS27300 (64693) 64693..64977 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
N4555_RS27305 (64977) 64977..65252 + 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4555_RS27310 (65347) 65347..65553 + 207 WP_001105064.1 hypothetical protein -
N4555_RS27315 (65653) 65653..65868 - 216 Protein_73 transposase -
N4555_RS27320 (65912) 65912..66478 - 567 Protein_74 IS3-like element IS600 family transposase -
N4555_RS27325 (66478) 66478..66894 - 417 Protein_75 IS91 family transposase -
N4555_RS27330 (66894) 66894..67079 - 186 WP_001302179.1 hypothetical protein -
N4555_RS27335 (67256) 67256..69466 + 2211 WP_000592771.1 catalase/peroxidase KatP -
N4555_RS27340 (69510) 69510..69899 + 390 WP_001172748.1 cytochrome b562 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyC / hlyA / hlyB / hlyD / toxB / espP / stcE / exeE / exeG 1..92729 92729


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T258737 WP_000421248.1 NZ_CP104640:64977-65252 [Escherichia coli]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT258737 WP_001178089.1 NZ_CP104640:64693-64977 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References