Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 19048..19573 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104640 | ||
| Organism | Escherichia coli strain PNUSAE014970 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | N4555_RS27050 | Protein ID | WP_001159868.1 |
| Coordinates | 19268..19573 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | N4555_RS27045 | Protein ID | WP_000813634.1 |
| Coordinates | 19048..19266 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4555_RS27015 (14331) | 14331..14561 | + | 231 | WP_010891288.1 | hypothetical protein | - |
| N4555_RS27020 (14682) | 14682..15422 | + | 741 | WP_001066920.1 | tyrosine-type recombinase/integrase | - |
| N4555_RS27025 (15707) | 15707..16684 | - | 978 | WP_000361615.1 | RepB family plasmid replication initiator protein | - |
| N4555_RS27030 (17092) | 17092..17292 | - | 201 | WP_000708307.1 | hypothetical protein | - |
| N4555_RS27035 (17289) | 17289..17909 | - | 621 | WP_001248529.1 | hypothetical protein | - |
| N4555_RS27040 (17906) | 17906..18589 | - | 684 | WP_010891291.1 | DNA-binding protein | - |
| N4555_RS27045 (19048) | 19048..19266 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| N4555_RS27050 (19268) | 19268..19573 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| N4555_RS27055 (19574) | 19574..20380 | + | 807 | WP_000016989.1 | site-specific integrase | - |
| N4555_RS27065 (22278) | 22278..22616 | + | 339 | WP_071525396.1 | RepB family plasmid replication initiator protein | - |
| N4555_RS27070 (23204) | 23204..24370 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyC / hlyA / hlyB / hlyD / toxB / espP / stcE / exeE / exeG | 1..92729 | 92729 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T258736 WP_001159868.1 NZ_CP104640:19268-19573 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|