Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 4859897..4860535 | Replicon | chromosome |
Accession | NZ_CP104639 | ||
Organism | Escherichia coli strain PNUSAE014970 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N4555_RS24040 | Protein ID | WP_000813794.1 |
Coordinates | 4859897..4860073 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4555_RS24045 | Protein ID | WP_001270286.1 |
Coordinates | 4860119..4860535 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4555_RS24020 (4855519) | 4855519..4856691 | - | 1173 | WP_001236316.1 | BenE family transporter YdcO | - |
N4555_RS24025 (4856783) | 4856783..4857319 | + | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
N4555_RS24030 (4857392) | 4857392..4859353 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N4555_RS24035 (4859445) | 4859445..4859675 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N4555_RS24040 (4859897) | 4859897..4860073 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N4555_RS24045 (4860119) | 4860119..4860535 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N4555_RS24050 (4860614) | 4860614..4862020 | + | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
N4555_RS24055 (4862265) | 4862265..4863410 | + | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
N4555_RS24060 (4863428) | 4863428..4864441 | + | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
N4555_RS24065 (4864442) | 4864442..4865383 | + | 942 | WP_001251320.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258730 WP_000813794.1 NZ_CP104639:4859897-4860073 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT258730 WP_001270286.1 NZ_CP104639:4860119-4860535 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|