Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4242221..4243016 | Replicon | chromosome |
Accession | NZ_CP104639 | ||
Organism | Escherichia coli strain PNUSAE014970 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B7UP43 |
Locus tag | N4555_RS20475 | Protein ID | WP_000854914.1 |
Coordinates | 4242642..4243016 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0B0VS41 |
Locus tag | N4555_RS20470 | Protein ID | WP_001280954.1 |
Coordinates | 4242221..4242595 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4555_RS20440 (4237576) | 4237576..4238481 | + | 906 | WP_000203541.1 | diguanylate cyclase regulator RdcB family protein | - |
N4555_RS20445 (4238478) | 4238478..4239548 | + | 1071 | WP_000102669.1 | patatin-like phospholipase family protein | - |
N4555_RS20450 (4239888) | 4239888..4240706 | + | 819 | WP_001234682.1 | DUF932 domain-containing protein | - |
N4555_RS20455 (4240797) | 4240797..4241282 | + | 486 | WP_000214398.1 | antirestriction protein | - |
N4555_RS20460 (4241298) | 4241298..4241774 | + | 477 | WP_001186738.1 | RadC family protein | - |
N4555_RS20465 (4241837) | 4241837..4242058 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
N4555_RS20470 (4242221) | 4242221..4242595 | + | 375 | WP_001280954.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N4555_RS20475 (4242642) | 4242642..4243016 | + | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
N4555_RS20480 (4243013) | 4243013..4243504 | + | 492 | WP_000976853.1 | DUF5983 family protein | - |
N4555_RS20485 (4243516) | 4243516..4243713 | + | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
N4555_RS20490 (4243798) | 4243798..4244640 | + | 843 | WP_001280481.1 | DUF4942 domain-containing protein | - |
N4555_RS20500 (4245111) | 4245111..4246049 | + | 939 | WP_000351284.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
N4555_RS20505 (4246104) | 4246104..4246841 | + | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
N4555_RS20510 (4246865) | 4246865..4247419 | + | 555 | WP_001001917.1 | molecular chaperone YcdY | - |
N4555_RS20515 (4247521) | 4247521..4248012 | + | 492 | WP_001301587.1 | DUF1097 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T258726 WP_000854914.1 NZ_CP104639:4242642-4243016 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13718.51 Da Isoelectric Point: 6.6249
>AT258726 WP_001280954.1 NZ_CP104639:4242221-4242595 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LXR5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0VS41 |