Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4242221..4243016 Replicon chromosome
Accession NZ_CP104639
Organism Escherichia coli strain PNUSAE014970

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag N4555_RS20475 Protein ID WP_000854914.1
Coordinates 4242642..4243016 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0B0VS41
Locus tag N4555_RS20470 Protein ID WP_001280954.1
Coordinates 4242221..4242595 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4555_RS20440 (4237576) 4237576..4238481 + 906 WP_000203541.1 diguanylate cyclase regulator RdcB family protein -
N4555_RS20445 (4238478) 4238478..4239548 + 1071 WP_000102669.1 patatin-like phospholipase family protein -
N4555_RS20450 (4239888) 4239888..4240706 + 819 WP_001234682.1 DUF932 domain-containing protein -
N4555_RS20455 (4240797) 4240797..4241282 + 486 WP_000214398.1 antirestriction protein -
N4555_RS20460 (4241298) 4241298..4241774 + 477 WP_001186738.1 RadC family protein -
N4555_RS20465 (4241837) 4241837..4242058 + 222 WP_001220314.1 DUF987 domain-containing protein -
N4555_RS20470 (4242221) 4242221..4242595 + 375 WP_001280954.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N4555_RS20475 (4242642) 4242642..4243016 + 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
N4555_RS20480 (4243013) 4243013..4243504 + 492 WP_000976853.1 DUF5983 family protein -
N4555_RS20485 (4243516) 4243516..4243713 + 198 WP_000839282.1 DUF957 domain-containing protein -
N4555_RS20490 (4243798) 4243798..4244640 + 843 WP_001280481.1 DUF4942 domain-containing protein -
N4555_RS20500 (4245111) 4245111..4246049 + 939 WP_000351284.1 glyoxylate/hydroxypyruvate reductase GhrA -
N4555_RS20505 (4246104) 4246104..4246841 + 738 WP_000283664.1 zinc-binding phosphatase -
N4555_RS20510 (4246865) 4246865..4247419 + 555 WP_001001917.1 molecular chaperone YcdY -
N4555_RS20515 (4247521) 4247521..4248012 + 492 WP_001301587.1 DUF1097 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T258726 WP_000854914.1 NZ_CP104639:4242642-4243016 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13718.51 Da        Isoelectric Point: 6.6249

>AT258726 WP_001280954.1 NZ_CP104639:4242221-4242595 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A0B0VS41

References