Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3955400..3955878 Replicon chromosome
Accession NZ_CP104639
Organism Escherichia coli strain PNUSAE014970

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag N4555_RS18835 Protein ID WP_001303876.1
Coordinates 3955400..3955687 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag N4555_RS18840 Protein ID WP_000536233.1
Coordinates 3955687..3955878 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4555_RS18800 (3950547) 3950547..3953020 - 2474 Protein_3655 3'-5' exoribonuclease -
N4555_RS18805 (3953114) 3953114..3953305 - 192 WP_001098307.1 DUF1482 family protein -
N4555_RS18810 (3953302) 3953302..3953490 - 189 WP_000413705.1 cell division inhibition protein DicB -
N4555_RS18815 (3954064) 3954064..3954249 + 186 WP_001133046.1 hypothetical protein -
N4555_RS18820 (3954436) 3954436..3954825 - 390 WP_000394511.1 hypothetical protein -
N4555_RS18825 (3954837) 3954837..3954965 - 129 WP_000344963.1 protein YdfB -
N4555_RS18830 (3954967) 3954967..3955122 - 156 WP_000379575.1 DUF1391 family protein -
N4555_RS18835 (3955400) 3955400..3955687 - 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4555_RS18840 (3955687) 3955687..3955878 - 192 WP_000536233.1 hypothetical protein Antitoxin
N4555_RS18845 (3955906) 3955906..3956307 - 402 WP_000986592.1 helix-turn-helix domain-containing protein -
N4555_RS18850 (3956416) 3956416..3956688 + 273 WP_000887453.1 YdaS family helix-turn-helix protein -
N4555_RS18855 (3956672) 3956672..3957097 + 426 WP_000693855.1 toxin YdaT family protein -
N4555_RS18860 (3957304) 3957304..3957759 - 456 WP_000273724.1 hypothetical protein -
N4555_RS18865 (3957838) 3957838..3958929 + 1092 WP_001205823.1 hypothetical protein -
N4555_RS18870 (3958936) 3958936..3959682 + 747 WP_000788751.1 ATP-binding protein -
N4555_RS18875 (3959704) 3959704..3960474 + 771 WP_000450992.1 DUF1627 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T258725 WP_001303876.1 NZ_CP104639:c3955687-3955400 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT258725 WP_000536233.1 NZ_CP104639:c3955878-3955687 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References