Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3789010..3789715 | Replicon | chromosome |
Accession | NZ_CP104639 | ||
Organism | Escherichia coli strain PNUSAE014970 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q8X3N0 |
Locus tag | N4555_RS18080 | Protein ID | WP_000539519.1 |
Coordinates | 3789329..3789715 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N4555_RS18075 | Protein ID | WP_001280945.1 |
Coordinates | 3789010..3789339 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4555_RS18060 (3784167) | 3784167..3785078 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
N4555_RS18065 (3785256) | 3785256..3787604 | + | 2349 | WP_000950320.1 | EAL domain-containing protein | - |
N4555_RS18070 (3787612) | 3787612..3788940 | + | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
N4555_RS18075 (3789010) | 3789010..3789339 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N4555_RS18080 (3789329) | 3789329..3789715 | - | 387 | WP_000539519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4555_RS18085 (3789941) | 3789941..3791266 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N4555_RS18090 (3791479) | 3791479..3791862 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N4555_RS18095 (3791973) | 3791973..3793088 | + | 1116 | WP_000554959.1 | aldose sugar dehydrogenase YliI | - |
N4555_RS18100 (3793085) | 3793085..3793711 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14279.42 Da Isoelectric Point: 9.9296
>T258724 WP_000539519.1 NZ_CP104639:c3789715-3789329 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|