Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 2595302..2595897 | Replicon | chromosome |
| Accession | NZ_CP104639 | ||
| Organism | Escherichia coli strain PNUSAE014970 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | N4555_RS12645 | Protein ID | WP_000239579.1 |
| Coordinates | 2595547..2595897 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | Q8XCF3 |
| Locus tag | N4555_RS12640 | Protein ID | WP_001223210.1 |
| Coordinates | 2595302..2595553 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4555_RS12630 (2590967) | 2590967..2594746 | + | 3780 | WP_000060930.1 | autotransporter assembly complex protein TamB | - |
| N4555_RS12635 (2594749) | 2594749..2595090 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| N4555_RS12640 (2595302) | 2595302..2595553 | + | 252 | WP_001223210.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| N4555_RS12645 (2595547) | 2595547..2595897 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| N4555_RS12650 (2595977) | 2595977..2596507 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| N4555_RS12655 (2596817) | 2596817..2597773 | + | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| N4555_RS12660 (2597913) | 2597913..2599415 | + | 1503 | WP_000205806.1 | sugar ABC transporter ATP-binding protein | - |
| N4555_RS12665 (2599429) | 2599429..2600451 | + | 1023 | WP_001301928.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T258720 WP_000239579.1 NZ_CP104639:2595547-2595897 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|