Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 1646993..1647793 | Replicon | chromosome |
| Accession | NZ_CP104639 | ||
| Organism | Escherichia coli strain PNUSAE014970 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A891SNC1 |
| Locus tag | N4555_RS08160 | Protein ID | WP_000342448.1 |
| Coordinates | 1646993..1647520 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | N4555_RS08165 | Protein ID | WP_001277108.1 |
| Coordinates | 1647527..1647793 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4555_RS08135 (1642068) | 1642068..1642835 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| N4555_RS08140 (1642832) | 1642832..1644109 | - | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
| N4555_RS08145 (1644106) | 1644106..1645032 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| N4555_RS08150 (1645080) | 1645080..1646189 | - | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| N4555_RS08155 (1646613) | 1646613..1646996 | + | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| N4555_RS08160 (1646993) | 1646993..1647520 | - | 528 | WP_000342448.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| N4555_RS08165 (1647527) | 1647527..1647793 | - | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| N4555_RS08170 (1647943) | 1647943..1649046 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| N4555_RS08175 (1649317) | 1649317..1650171 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| N4555_RS08180 (1650416) | 1650416..1651474 | - | 1059 | WP_001042018.1 | permease-like cell division protein FtsX | - |
| N4555_RS08185 (1651467) | 1651467..1652135 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19692.68 Da Isoelectric Point: 7.3232
>T258715 WP_000342448.1 NZ_CP104639:c1647520-1646993 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|