Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1598138..1598892 | Replicon | chromosome |
Accession | NZ_CP104639 | ||
Organism | Escherichia coli strain PNUSAE014970 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | N4555_RS07950 | Protein ID | WP_001301452.1 |
Coordinates | 1598407..1598892 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q8X700 |
Locus tag | N4555_RS07945 | Protein ID | WP_000801912.1 |
Coordinates | 1598138..1598416 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4555_RS07940 (1595366) | 1595366..1598071 | + | 2706 | WP_000906970.1 | HTH-type transcriptional regulator MalT | - |
N4555_RS07945 (1598138) | 1598138..1598416 | + | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
N4555_RS07950 (1598407) | 1598407..1598892 | + | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
N4555_RS07955 (1598942) | 1598942..1599970 | - | 1029 | WP_000827117.1 | RNA 3'-terminal phosphate cyclase | - |
N4555_RS07960 (1599974) | 1599974..1601200 | - | 1227 | WP_001105473.1 | RNA-splicing ligase RtcB | - |
N4555_RS07965 (1601388) | 1601388..1602986 | + | 1599 | WP_001232889.1 | DNA-binding transcriptional regulator RtcR | - |
N4555_RS07970 (1602968) | 1602968..1603726 | - | 759 | WP_001302007.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T258714 WP_001301452.1 NZ_CP104639:1598407-1598892 [Escherichia coli]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|