Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1108741..1109395 | Replicon | chromosome |
Accession | NZ_CP104639 | ||
Organism | Escherichia coli strain PNUSAE014970 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N4555_RS05425 | Protein ID | WP_000244781.1 |
Coordinates | 1108741..1109148 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N4555_RS05430 | Protein ID | WP_000354046.1 |
Coordinates | 1109129..1109395 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4555_RS05405 (1104698) | 1104698..1106431 | - | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
N4555_RS05410 (1106437) | 1106437..1107147 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N4555_RS05415 (1107172) | 1107172..1108068 | - | 897 | WP_000806640.1 | site-specific tyrosine recombinase XerD | - |
N4555_RS05420 (1108180) | 1108180..1108701 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
N4555_RS05425 (1108741) | 1108741..1109148 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
N4555_RS05430 (1109129) | 1109129..1109395 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N4555_RS05435 (1109638) | 1109638..1110618 | + | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
N4555_RS05440 (1110695) | 1110695..1111354 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
N4555_RS05445 (1111518) | 1111518..1111829 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
N4555_RS05450 (1111874) | 1111874..1113307 | + | 1434 | WP_001310226.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258711 WP_000244781.1 NZ_CP104639:c1109148-1108741 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|