Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 963331..963914 | Replicon | chromosome |
Accession | NZ_CP104639 | ||
Organism | Escherichia coli strain PNUSAE014970 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N4555_RS04765 | Protein ID | WP_000254738.1 |
Coordinates | 963331..963666 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N4555_RS04770 | Protein ID | WP_000581937.1 |
Coordinates | 963666..963914 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4555_RS04750 (959218) | 959218..960516 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
N4555_RS04755 (960604) | 960604..962241 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N4555_RS04760 (962469) | 962469..963260 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N4555_RS04765 (963331) | 963331..963666 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N4555_RS04770 (963666) | 963666..963914 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N4555_RS04775 (963992) | 963992..966226 | - | 2235 | WP_261628852.1 | GTP diphosphokinase | - |
N4555_RS04780 (966274) | 966274..967575 | - | 1302 | WP_000046824.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T258710 WP_000254738.1 NZ_CP104639:c963666-963331 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|