Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4637371..4638185 | Replicon | chromosome |
Accession | NZ_CP104638 | ||
Organism | Salmonella enterica strain PNUSAS118466 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | N4311_RS23600 | Protein ID | WP_000971655.1 |
Coordinates | 4637371..4637898 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | N4311_RS23605 | Protein ID | WP_000855694.1 |
Coordinates | 4637895..4638185 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4311_RS23570 (4633653) | 4633653..4634051 | + | 399 | Protein_4415 | cytoplasmic protein | - |
N4311_RS23575 (4634242) | 4634242..4634481 | + | 240 | Protein_4416 | hypothetical protein | - |
N4311_RS23580 (4634638) | 4634638..4635306 | + | 669 | WP_000445914.1 | hypothetical protein | - |
N4311_RS23585 (4635333) | 4635333..4635827 | + | 495 | WP_000424948.1 | hypothetical protein | - |
N4311_RS23590 (4635999) | 4635999..4636655 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
N4311_RS23595 (4636888) | 4636888..4637298 | + | 411 | Protein_4420 | transposase | - |
N4311_RS23600 (4637371) | 4637371..4637898 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
N4311_RS23605 (4637895) | 4637895..4638185 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
N4311_RS23610 (4638455) | 4638455..4638633 | - | 179 | Protein_4423 | IS3 family transposase | - |
N4311_RS23615 (4638874) | 4638874..4639200 | + | 327 | WP_000393302.1 | hypothetical protein | - |
N4311_RS23620 (4639473) | 4639473..4639820 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
N4311_RS23625 (4639805) | 4639805..4640254 | - | 450 | WP_000381610.1 | membrane protein | - |
N4311_RS23630 (4640686) | 4640686..4641129 | - | 444 | WP_000715099.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
N4311_RS23635 (4641585) | 4641585..4642235 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4637074..4637298 | 224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T258709 WP_000971655.1 NZ_CP104638:c4637898-4637371 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |