Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4482706..4483331 | Replicon | chromosome |
Accession | NZ_CP104638 | ||
Organism | Salmonella enterica strain PNUSAS118466 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N4311_RS22915 | Protein ID | WP_000911337.1 |
Coordinates | 4482933..4483331 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | N4311_RS22910 | Protein ID | WP_000557545.1 |
Coordinates | 4482706..4482933 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4311_RS22880 (4477751) | 4477751..4479268 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
N4311_RS22885 (4479344) | 4479344..4479889 | - | 546 | WP_000133986.1 | isopentenyl-diphosphate Delta-isomerase | - |
N4311_RS22890 (4480154) | 4480154..4480912 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
N4311_RS22900 (4481197) | 4481197..4482003 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
N4311_RS22905 (4482278) | 4482278..4482529 | - | 252 | WP_001540858.1 | hypothetical protein | - |
N4311_RS22910 (4482706) | 4482706..4482933 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4311_RS22915 (4482933) | 4482933..4483331 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
N4311_RS22920 (4484139) | 4484139..4484675 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
N4311_RS22925 (4484722) | 4484722..4485354 | + | 633 | WP_000835265.1 | YfdX family protein | - |
N4311_RS22930 (4486073) | 4486073..4486654 | + | 582 | WP_001244652.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4482278..4491114 | 8836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T258708 WP_000911337.1 NZ_CP104638:4482933-4483331 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|