Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3108206..3108987 | Replicon | chromosome |
Accession | NZ_CP104638 | ||
Organism | Salmonella enterica strain PNUSAS118466 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | N4311_RS16320 | Protein ID | WP_000625912.1 |
Coordinates | 3108206..3108697 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | N4311_RS16325 | Protein ID | WP_001110450.1 |
Coordinates | 3108694..3108987 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4311_RS16290 (3104467) | 3104467..3104964 | - | 498 | WP_001670425.1 | FimD/PapC N-terminal domain-containing protein | - |
N4311_RS16295 (3105088) | 3105088..3105918 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
N4311_RS16300 (3106120) | 3106120..3106425 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
N4311_RS16305 (3106956) | 3106956..3107099 | + | 144 | Protein_3009 | transposase | - |
N4311_RS16310 (3107116) | 3107116..3107462 | + | 347 | Protein_3010 | Rpn family recombination-promoting nuclease/putative transposase | - |
N4311_RS16315 (3107743) | 3107743..3107991 | - | 249 | Protein_3011 | IS481 family transposase | - |
N4311_RS16320 (3108206) | 3108206..3108697 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
N4311_RS16325 (3108694) | 3108694..3108987 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
N4311_RS16330 (3109304) | 3109304..3109526 | + | 223 | Protein_3014 | hypothetical protein | - |
N4311_RS16335 (3109790) | 3109790..3110665 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
N4311_RS16340 (3110662) | 3110662..3110949 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
N4311_RS16345 (3110942) | 3110942..3111124 | - | 183 | WP_001670702.1 | ATP-binding cassette domain-containing protein | - |
N4311_RS16350 (3111144) | 3111144..3111243 | + | 100 | Protein_3018 | hypothetical protein | - |
N4311_RS16355 (3111356) | 3111356..3111490 | + | 135 | Protein_3019 | hypothetical protein | - |
N4311_RS16360 (3111785) | 3111785..3112690 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3101296..3110949 | 9653 | |
- | inside | Genomic island | - | - | 3101296..3111124 | 9828 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T258703 WP_000625912.1 NZ_CP104638:c3108697-3108206 [Salmonella enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |