Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2991031..2991547 | Replicon | chromosome |
Accession | NZ_CP104638 | ||
Organism | Salmonella enterica strain PNUSAS118466 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0R9NWE9 |
Locus tag | N4311_RS15670 | Protein ID | WP_000220579.1 |
Coordinates | 2991031..2991315 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | N4311_RS15675 | Protein ID | WP_000212724.1 |
Coordinates | 2991305..2991547 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4311_RS15655 (2986147) | 2986147..2987799 | + | 1653 | WP_000155055.1 | alpha,alpha-phosphotrehalase | - |
N4311_RS15660 (2988208) | 2988208..2990346 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4311_RS15665 (2990563) | 2990563..2991027 | + | 465 | WP_001009175.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4311_RS15670 (2991031) | 2991031..2991315 | - | 285 | WP_000220579.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4311_RS15675 (2991305) | 2991305..2991547 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4311_RS15680 (2991625) | 2991625..2993538 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
N4311_RS15685 (2993555) | 2993555..2994295 | - | 741 | WP_000779247.1 | KDGP aldolase family protein | - |
N4311_RS15690 (2994292) | 2994292..2995410 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N4311_RS15695 (2995394) | 2995394..2996527 | - | 1134 | WP_000459949.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10884.70 Da Isoelectric Point: 10.0482
>T258702 WP_000220579.1 NZ_CP104638:c2991315-2991031 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NWE9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |