Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2301237..2301857 | Replicon | chromosome |
Accession | NZ_CP104638 | ||
Organism | Salmonella enterica strain PNUSAS118466 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N4311_RS12495 | Protein ID | WP_001280991.1 |
Coordinates | 2301639..2301857 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N4311_RS12490 | Protein ID | WP_000344807.1 |
Coordinates | 2301237..2301611 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4311_RS12480 (2296376) | 2296376..2297569 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4311_RS12485 (2297592) | 2297592..2300741 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N4311_RS12490 (2301237) | 2301237..2301611 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N4311_RS12495 (2301639) | 2301639..2301857 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N4311_RS12500 (2302036) | 2302036..2302587 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
N4311_RS12505 (2302704) | 2302704..2303174 | + | 471 | WP_000136181.1 | YlaC family protein | - |
N4311_RS12510 (2303230) | 2303230..2303370 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N4311_RS12515 (2303376) | 2303376..2303636 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
N4311_RS12520 (2303861) | 2303861..2305411 | + | 1551 | WP_000213138.1 | EAL domain-containing protein | - |
N4311_RS12530 (2305642) | 2305642..2306031 | + | 390 | WP_000961287.1 | MGMT family protein | - |
N4311_RS12535 (2306064) | 2306064..2306633 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258699 WP_001280991.1 NZ_CP104638:2301639-2301857 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258699 WP_000344807.1 NZ_CP104638:2301237-2301611 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|