Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4454735..4455330 | Replicon | chromosome |
Accession | NZ_CP104629 | ||
Organism | Escherichia coli strain AHM21C2872I |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | N5855_RS21360 | Protein ID | WP_000239579.1 |
Coordinates | 4454980..4455330 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | N5855_RS21355 | Protein ID | WP_001223208.1 |
Coordinates | 4454735..4454986 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5855_RS21345 (4450399) | 4450399..4454178 | + | 3780 | WP_021557470.1 | autotransporter assembly complex protein TamB | - |
N5855_RS21350 (4454181) | 4454181..4454522 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
N5855_RS21355 (4454735) | 4454735..4454986 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
N5855_RS21360 (4454980) | 4454980..4455330 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
N5855_RS21365 (4455410) | 4455410..4455940 | - | 531 | WP_000055072.1 | inorganic diphosphatase | - |
N5855_RS21370 (4456250) | 4456250..4457206 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
N5855_RS21375 (4457346) | 4457346..4458848 | + | 1503 | WP_021557471.1 | sugar ABC transporter ATP-binding protein | - |
N5855_RS21380 (4458862) | 4458862..4459884 | + | 1023 | WP_001313531.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T258686 WP_000239579.1 NZ_CP104629:4454980-4455330 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |