Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3012239..3013037 Replicon chromosome
Accession NZ_CP104629
Organism Escherichia coli strain AHM21C2872I

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag N5855_RS14440 Protein ID WP_000854735.1
Coordinates 3012660..3013037 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag N5855_RS14435 Protein ID WP_001285415.1
Coordinates 3012239..3012613 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5855_RS14400 (3008174) 3008174..3008854 + 681 WP_001593697.1 WYL domain-containing protein -
N5855_RS14405 (3009002) 3009002..3009679 + 678 WP_001097302.1 hypothetical protein -
N5855_RS14410 (3009685) 3009685..3009918 + 234 WP_001278287.1 DUF905 family protein -
N5855_RS14415 (3010008) 3010008..3010826 + 819 WP_001175148.1 DUF932 domain-containing protein -
N5855_RS14420 (3010908) 3010908..3011387 + 480 WP_000844100.1 antirestriction protein -
N5855_RS14425 (3011399) 3011399..3011875 + 477 WP_122994424.1 RadC family protein -
N5855_RS14430 (3011938) 3011938..3012159 + 222 WP_000692309.1 DUF987 domain-containing protein -
N5855_RS14435 (3012239) 3012239..3012613 + 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5855_RS14440 (3012660) 3012660..3013037 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
N5855_RS14445 (3013034) 3013034..3013522 + 489 WP_000761677.1 DUF5983 family protein -
N5855_RS14450 (3013534) 3013534..3013731 + 198 WP_000839291.1 DUF957 domain-containing protein -
N5855_RS14455 (3013816) 3013816..3014682 + 867 WP_001280433.1 DUF4942 domain-containing protein -
N5855_RS14460 (3014754) 3014754..3015017 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
N5855_RS14465 (3015014) 3015014..3015340 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5855_RS14470 (3015755) 3015755..3016291 - 537 WP_000942790.1 GspM family type II secretion system protein YghD -
N5855_RS14475 (3016293) 3016293..3017471 - 1179 WP_021557196.1 type II secretion system protein GspL -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2914541..3015340 100799


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T258681 WP_000854735.1 NZ_CP104629:3012660-3013037 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT258681 WP_001285415.1 NZ_CP104629:3012239-3012613 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References