Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3012239..3013037 | Replicon | chromosome |
| Accession | NZ_CP104629 | ||
| Organism | Escherichia coli strain AHM21C2872I | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | N5855_RS14440 | Protein ID | WP_000854735.1 |
| Coordinates | 3012660..3013037 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | N5855_RS14435 | Protein ID | WP_001285415.1 |
| Coordinates | 3012239..3012613 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5855_RS14400 (3008174) | 3008174..3008854 | + | 681 | WP_001593697.1 | WYL domain-containing protein | - |
| N5855_RS14405 (3009002) | 3009002..3009679 | + | 678 | WP_001097302.1 | hypothetical protein | - |
| N5855_RS14410 (3009685) | 3009685..3009918 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| N5855_RS14415 (3010008) | 3010008..3010826 | + | 819 | WP_001175148.1 | DUF932 domain-containing protein | - |
| N5855_RS14420 (3010908) | 3010908..3011387 | + | 480 | WP_000844100.1 | antirestriction protein | - |
| N5855_RS14425 (3011399) | 3011399..3011875 | + | 477 | WP_122994424.1 | RadC family protein | - |
| N5855_RS14430 (3011938) | 3011938..3012159 | + | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| N5855_RS14435 (3012239) | 3012239..3012613 | + | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5855_RS14440 (3012660) | 3012660..3013037 | + | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| N5855_RS14445 (3013034) | 3013034..3013522 | + | 489 | WP_000761677.1 | DUF5983 family protein | - |
| N5855_RS14450 (3013534) | 3013534..3013731 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| N5855_RS14455 (3013816) | 3013816..3014682 | + | 867 | WP_001280433.1 | DUF4942 domain-containing protein | - |
| N5855_RS14460 (3014754) | 3014754..3015017 | + | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| N5855_RS14465 (3015014) | 3015014..3015340 | + | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N5855_RS14470 (3015755) | 3015755..3016291 | - | 537 | WP_000942790.1 | GspM family type II secretion system protein YghD | - |
| N5855_RS14475 (3016293) | 3016293..3017471 | - | 1179 | WP_021557196.1 | type II secretion system protein GspL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2914541..3015340 | 100799 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T258681 WP_000854735.1 NZ_CP104629:3012660-3013037 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT258681 WP_001285415.1 NZ_CP104629:3012239-3012613 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067H947 |