Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 2764783..2765276 Replicon chromosome
Accession NZ_CP104629
Organism Escherichia coli strain AHM21C2872I

Toxin (Protein)


Gene name TsxA Uniprot ID -
Locus tag N5855_RS13205 Protein ID WP_284657317.1
Coordinates 2764783..2765037 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag N5855_RS13210 Protein ID WP_000151456.1
Coordinates 2765034..2765276 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5855_RS13170 (2759845) 2759845..2760102 + 258 WP_000764642.1 hypothetical protein -
N5855_RS13175 (2760160) 2760160..2760936 - 777 WP_000015958.1 site-specific integrase -
N5855_RS13180 (2760933) 2760933..2761676 - 744 WP_000129823.1 hypothetical protein -
N5855_RS13185 (2761727) 2761727..2762077 - 351 WP_000493378.1 hypothetical protein -
N5855_RS13190 (2762892) 2762892..2763221 + 330 WP_000855119.1 hypothetical protein -
N5855_RS13195 (2763625) 2763625..2764140 + 516 WP_001025393.1 J domain-containing protein -
N5855_RS13200 (2764244) 2764244..2764786 + 543 WP_001083904.1 hypothetical protein -
N5855_RS13205 (2764783) 2764783..2765037 + 255 WP_284657317.1 hypothetical protein Toxin
N5855_RS13210 (2765034) 2765034..2765276 + 243 WP_000151456.1 hypothetical protein Antitoxin
N5855_RS13215 (2765401) 2765401..2765745 + 345 Protein_2586 WbuC family cupin fold metalloprotein -
N5855_RS13220 (2765792) 2765792..2766667 - 876 WP_031942271.1 extended-spectrum class A beta-lactamase CTX-M-123 -
N5855_RS13230 (2767789) 2767789..2768958 - 1170 Protein_2589 IS1380-like element ISEcp1 family transposase -
N5855_RS13235 (2769190) 2769190..2770116 + 927 WP_001290416.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island aac(3)-IVa / aph(4)-Ia / sul2 / floR / dfrA12 / blaCTX-M-123 / fosA3 / catA1 - 2722698..2792899 70201


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9968.55 Da        Isoelectric Point: 10.1206

>T258679 WP_284657317.1 NZ_CP104629:2764783-2765037 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
EIDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT258679 WP_000151456.1 NZ_CP104629:2765034-2765276 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References