Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 198709..199327 | Replicon | chromosome |
| Accession | NZ_CP104629 | ||
| Organism | Escherichia coli strain AHM21C2872I | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N5855_RS00885 | Protein ID | WP_001291435.1 |
| Coordinates | 198709..198927 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N5855_RS00890 | Protein ID | WP_000344800.1 |
| Coordinates | 198953..199327 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5855_RS00850 (193999) | 193999..194571 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
| N5855_RS00855 (194602) | 194602..194913 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| N5855_RS00865 (195292) | 195292..195645 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| N5855_RS00870 (195687) | 195687..197237 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N5855_RS00875 (197401) | 197401..197871 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| N5855_RS00880 (197987) | 197987..198538 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| N5855_RS00885 (198709) | 198709..198927 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N5855_RS00890 (198953) | 198953..199327 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N5855_RS00895 (199873) | 199873..203022 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| N5855_RS00900 (203045) | 203045..204238 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258671 WP_001291435.1 NZ_CP104629:c198927-198709 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258671 WP_000344800.1 NZ_CP104629:c199327-198953 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |