Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5128117..5128742 | Replicon | chromosome |
Accession | NZ_CP104627 | ||
Organism | Klebsiella pneumoniae strain AHM21C2836KI |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N5857_RS24825 | Protein ID | WP_047718441.1 |
Coordinates | 5128117..5128500 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | N5857_RS24830 | Protein ID | WP_004150355.1 |
Coordinates | 5128500..5128742 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5857_RS24810 (5125483) | 5125483..5126385 | + | 903 | WP_109963920.1 | formate dehydrogenase subunit beta | - |
N5857_RS24815 (5126382) | 5126382..5127017 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
N5857_RS24820 (5127014) | 5127014..5127943 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
N5857_RS24825 (5128117) | 5128117..5128500 | - | 384 | WP_047718441.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5857_RS24830 (5128500) | 5128500..5128742 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
N5857_RS24835 (5128947) | 5128947..5129864 | + | 918 | WP_200541565.1 | alpha/beta hydrolase | - |
N5857_RS24840 (5129878) | 5129878..5130819 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
N5857_RS24845 (5130864) | 5130864..5131301 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
N5857_RS24850 (5131298) | 5131298..5132158 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
N5857_RS24855 (5132152) | 5132152..5132751 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14350.59 Da Isoelectric Point: 7.3178
>T258669 WP_047718441.1 NZ_CP104627:c5128500-5128117 [Klebsiella pneumoniae]
MTSGSALFDTSILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTSILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|