Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3949445..3950064 Replicon chromosome
Accession NZ_CP104627
Organism Klebsiella pneumoniae strain AHM21C2836KI

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N5857_RS19230 Protein ID WP_002892050.1
Coordinates 3949846..3950064 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N5857_RS19225 Protein ID WP_002892066.1
Coordinates 3949445..3949819 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5857_RS19215 (3944597) 3944597..3945790 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N5857_RS19220 (3945813) 3945813..3948959 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N5857_RS19225 (3949445) 3949445..3949819 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N5857_RS19230 (3949846) 3949846..3950064 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N5857_RS19235 (3950227) 3950227..3950793 + 567 WP_002892030.1 maltose O-acetyltransferase -
N5857_RS19240 (3950765) 3950765..3950905 - 141 WP_004147370.1 hypothetical protein -
N5857_RS19245 (3950926) 3950926..3951396 + 471 WP_002892026.1 YlaC family protein -
N5857_RS19250 (3951371) 3951371..3952822 - 1452 WP_200541409.1 PLP-dependent aminotransferase family protein -
N5857_RS19255 (3952923) 3952923..3953621 + 699 WP_117260135.1 GNAT family protein -
N5857_RS19260 (3953618) 3953618..3953758 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N5857_RS19265 (3953758) 3953758..3954021 - 264 WP_200541410.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T258665 WP_002892050.1 NZ_CP104627:3949846-3950064 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT258665 WP_002892066.1 NZ_CP104627:3949445-3949819 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References