Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3949445..3950064 | Replicon | chromosome |
Accession | NZ_CP104627 | ||
Organism | Klebsiella pneumoniae strain AHM21C2836KI |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | N5857_RS19230 | Protein ID | WP_002892050.1 |
Coordinates | 3949846..3950064 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | N5857_RS19225 | Protein ID | WP_002892066.1 |
Coordinates | 3949445..3949819 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5857_RS19215 (3944597) | 3944597..3945790 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N5857_RS19220 (3945813) | 3945813..3948959 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N5857_RS19225 (3949445) | 3949445..3949819 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
N5857_RS19230 (3949846) | 3949846..3950064 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
N5857_RS19235 (3950227) | 3950227..3950793 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
N5857_RS19240 (3950765) | 3950765..3950905 | - | 141 | WP_004147370.1 | hypothetical protein | - |
N5857_RS19245 (3950926) | 3950926..3951396 | + | 471 | WP_002892026.1 | YlaC family protein | - |
N5857_RS19250 (3951371) | 3951371..3952822 | - | 1452 | WP_200541409.1 | PLP-dependent aminotransferase family protein | - |
N5857_RS19255 (3952923) | 3952923..3953621 | + | 699 | WP_117260135.1 | GNAT family protein | - |
N5857_RS19260 (3953618) | 3953618..3953758 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
N5857_RS19265 (3953758) | 3953758..3954021 | - | 264 | WP_200541410.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258665 WP_002892050.1 NZ_CP104627:3949846-3950064 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT258665 WP_002892066.1 NZ_CP104627:3949445-3949819 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |