Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 57278..57800 Replicon plasmid pHNAH968-3
Accession NZ_CP104622
Organism Escherichia coli strain AHM9C68I

Toxin (Protein)


Gene name relE Uniprot ID U9YLU1
Locus tag N5859_RS24770 Protein ID WP_000638823.1
Coordinates 57278..57559 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y7J1
Locus tag N5859_RS24775 Protein ID WP_000121741.1
Coordinates 57549..57800 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5859_RS24735 (N5859_24650) 53427..53747 - 321 WP_000362080.1 VirB3 family type IV secretion system protein -
N5859_RS24740 (N5859_24655) 53818..54108 - 291 WP_000865479.1 conjugal transfer protein -
N5859_RS24745 (N5859_24660) 54108..54692 - 585 WP_001177113.1 lytic transglycosylase domain-containing protein -
N5859_RS24750 (N5859_24665) 54713..55111 - 399 WP_072643816.1 hypothetical protein -
N5859_RS24755 (N5859_24670) 55230..55667 - 438 WP_000539665.1 type IV pilus biogenesis protein PilM -
N5859_RS24760 (N5859_24675) 55673..56908 - 1236 WP_015059538.1 TcpQ domain-containing protein -
N5859_RS24765 (N5859_24680) 56911..57210 - 300 WP_000835764.1 TrbM/KikA/MpfK family conjugal transfer protein -
N5859_RS24770 (N5859_24685) 57278..57559 - 282 WP_000638823.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5859_RS24775 (N5859_24690) 57549..57800 - 252 WP_000121741.1 hypothetical protein Antitoxin
N5859_RS24780 (N5859_24695) 57900..58535 - 636 WP_015059536.1 hypothetical protein -
N5859_RS24785 (N5859_24700) 58608..58895 - 288 WP_001032611.1 EexN family lipoprotein -
N5859_RS24790 (N5859_24705) 58908..59162 - 255 WP_001043555.1 EexN family lipoprotein -
N5859_RS24795 (N5859_24710) 59164..59805 - 642 WP_227311782.1 type IV secretion system protein -
N5859_RS24800 (N5859_24715) 59811..60806 - 996 WP_001028543.1 type IV secretion system protein -
N5859_RS24805 (N5859_24720) 60810..61067 - 258 WP_000739144.1 hypothetical protein -
N5859_RS24810 (N5859_24725) 61064..61417 - 354 WP_223286767.1 hypothetical protein -
N5859_RS24815 (N5859_24730) 61637..62083 - 447 WP_001243165.1 hypothetical protein -
N5859_RS24820 (N5859_24735) 62094..62264 - 171 WP_000550720.1 hypothetical protein -
N5859_RS24825 (N5859_24740) 62268..62711 - 444 WP_000964330.1 NfeD family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-55 / mcr-1.1 - 1..66033 66033


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10945.79 Da        Isoelectric Point: 10.4997

>T258654 WP_000638823.1 NZ_CP104622:c57559-57278 [Escherichia coli]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9223.38 Da        Isoelectric Point: 3.9823

>AT258654 WP_000121741.1 NZ_CP104622:c57800-57549 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YLU1

Antitoxin

Source ID Structure
AlphaFold DB U9Y7J1

References