258652

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 6323..6816 Replicon plasmid pHNAH968-3
Accession NZ_CP104622
Organism Escherichia coli strain AHM9C68I

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag N5859_RS24475 Protein ID WP_001230709.1
Coordinates 6323..6577 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag N5859_RS24480 Protein ID WP_000151456.1
Coordinates 6574..6816 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5859_RS24430 (N5859_24345) 1730..1920 + 191 Protein_1 hypothetical protein -
N5859_RS24435 (N5859_24350) 2083..2244 + 162 WP_001128311.1 hypothetical protein -
N5859_RS24440 (N5859_24355) 2570..2722 + 153 Protein_3 DUF5431 family protein -
N5859_RS24445 (N5859_24360) 2667..2789 + 123 WP_223170659.1 type I toxin-antitoxin system Hok family toxin -
N5859_RS24450 (N5859_24365) 2939..3535 + 597 WP_000125165.1 ProQ/FINO family protein -
N5859_RS24455 (N5859_24370) 3553..3837 - 285 WP_001162371.1 hypothetical protein -
N5859_RS24460 (N5859_24375) 3911..4576 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
N5859_RS24465 (N5859_24380) 5165..5680 + 516 WP_001025393.1 J domain-containing protein -
N5859_RS24470 (N5859_24385) 5784..6326 + 543 WP_001083904.1 hypothetical protein -
N5859_RS24475 (N5859_24390) 6323..6577 + 255 WP_001230709.1 hypothetical protein Toxin
N5859_RS24480 (N5859_24395) 6574..6816 + 243 WP_000151456.1 hypothetical protein Antitoxin
N5859_RS24485 (N5859_24400) 6941..7285 + 345 Protein_12 WbuC family cupin fold metalloprotein -
N5859_RS24490 (N5859_24405) 7332..8207 - 876 WP_015387340.1 extended-spectrum class A beta-lactamase CTX-M-55 -
N5859_RS24495 (N5859_24410) 8460..9722 - 1263 WP_000608644.1 IS1380-like element ISEcp1 family transposase -
N5859_RS24500 (N5859_24415) 10480..10809 + 330 WP_000855120.1 hypothetical protein -
N5859_RS24505 (N5859_24420) 10918..11064 - 147 WP_001356709.1 hypothetical protein -
N5859_RS24510 (N5859_24425) 11391..11714 + 324 WP_000427403.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-55 / mcr-1.1 - 1..66033 66033
- flank IS/Tn blaCTX-M-55 - 7332..9722 2390


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T258652 WP_001230709.1 NZ_CP104622:6323-6577 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT258652 WP_000151456.1 NZ_CP104622:6574-6816 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References