Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6700..7343 Replicon plasmid pHNAH968-2
Accession NZ_CP104621
Organism Escherichia coli strain AHM9C68I

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag N5859_RS23950 Protein ID WP_001044768.1
Coordinates 6927..7343 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag N5859_RS23945 Protein ID WP_001261287.1
Coordinates 6700..6930 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5859_RS23910 (1797) 1797..2258 + 462 WP_072643484.1 histidine phosphatase family protein -
N5859_RS23915 (2414) 2414..2680 - 267 Protein_2 IS91 family transposase -
N5859_RS23920 (2782) 2782..3954 + 1173 WP_000952428.1 IS21-like element ISEc62 family transposase -
N5859_RS23925 (3954) 3954..4748 + 795 WP_000544809.1 IS21-like element helper ATPase IstB -
N5859_RS23930 (4804) 4804..5742 - 939 Protein_5 IS91-like element IS1294 family transposase -
N5859_RS23935 (5752) 5752..5940 - 189 WP_000957857.1 hypothetical protein -
N5859_RS23940 (6114) 6114..6404 - 291 WP_000111771.1 hypothetical protein -
N5859_RS23945 (6700) 6700..6930 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5859_RS23950 (6927) 6927..7343 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
N5859_RS23955 (7505) 7505..9643 - 2139 WP_000350638.1 AAA family ATPase -
N5859_RS23960 (9997) 9997..10254 + 258 WP_000343085.1 hypothetical protein -
N5859_RS23965 (10254) 10254..10844 + 591 WP_000194575.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 / blaTEM-1B / rmtB - 1..84082 84082


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T258648 WP_001044768.1 NZ_CP104621:6927-7343 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT258648 WP_001261287.1 NZ_CP104621:6700-6930 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References