Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 91864..92662 | Replicon | plasmid pHNAH968 |
| Accession | NZ_CP104619 | ||
| Organism | Escherichia coli strain AHM9C68I | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | N5859_RS23075 | Protein ID | WP_032187665.1 |
| Coordinates | 92141..92662 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A141BRA2 |
| Locus tag | N5859_RS23070 | Protein ID | WP_001711191.1 |
| Coordinates | 91864..92133 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5859_RS23045 (N5859_22955) | 87291..88631 | - | 1341 | WP_097296309.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| N5859_RS23050 (N5859_22960) | 88692..89417 | - | 726 | WP_284632850.1 | hypothetical protein | - |
| N5859_RS23055 (N5859_22965) | 89700..90467 | + | 768 | WP_001711193.1 | hypothetical protein | - |
| N5859_RS23060 (N5859_22970) | 90520..90873 | - | 354 | WP_161953766.1 | hypothetical protein | - |
| N5859_RS23065 (N5859_22975) | 90879..91544 | - | 666 | WP_023135658.1 | AAA family ATPase | - |
| N5859_RS23070 (N5859_22980) | 91864..92133 | + | 270 | WP_001711191.1 | DUF1778 domain-containing protein | Antitoxin |
| N5859_RS23075 (N5859_22985) | 92141..92662 | + | 522 | WP_032187665.1 | GNAT family N-acetyltransferase | Toxin |
| N5859_RS23080 (N5859_22990) | 92831..93082 | - | 252 | WP_023135660.1 | hypothetical protein | - |
| N5859_RS23085 (N5859_22995) | 93260..93448 | + | 189 | WP_000957857.1 | hypothetical protein | - |
| N5859_RS23090 (N5859_23000) | 93458..94657 | + | 1200 | WP_000948429.1 | IS91 family transposase | - |
| N5859_RS23095 (N5859_23005) | 94821..95465 | - | 645 | WP_284632852.1 | hypothetical protein | - |
| N5859_RS23100 (N5859_23010) | 95479..95802 | - | 324 | WP_001711185.1 | hypothetical protein | - |
| N5859_RS23105 (N5859_23015) | 95936..96517 | - | 582 | WP_213846801.1 | tail fiber assembly protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / blaNDM-1 / sul2 / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / mph(A) / aph(3')-Ia | htpB | 1..133317 | 133317 | |
| - | flank | IS/Tn | - | - | 93458..94657 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19345.11 Da Isoelectric Point: 7.7881
>T258644 WP_032187665.1 NZ_CP104619:92141-92662 [Escherichia coli]
VSNTTIEIFSGENDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRNVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
VSNTTIEIFSGENDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRNVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|