Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 85287..85885 Replicon plasmid pHNAH968
Accession NZ_CP104619
Organism Escherichia coli strain AHM9C68I

Toxin (Protein)


Gene name doc Uniprot ID L4J396
Locus tag N5859_RS23035 Protein ID WP_001603496.1
Coordinates 85508..85885 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID L4J1C0
Locus tag N5859_RS23030 Protein ID WP_001603498.1
Coordinates 85287..85508 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5859_RS23010 (N5859_22920) 80293..80841 + 549 WP_074014839.1 fimbrial protein YehD -
N5859_RS23015 (N5859_22925) 80897..81577 + 681 WP_032187672.1 fimbrial assembly chaperone -
N5859_RS23020 (N5859_22930) 81595..84081 + 2487 WP_212403473.1 fimbrial biogenesis outer membrane usher protein -
N5859_RS23025 (N5859_22935) 84092..85102 + 1011 WP_032187670.1 fimbrial protein -
N5859_RS23030 (N5859_22940) 85287..85508 + 222 WP_001603498.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5859_RS23035 (N5859_22945) 85508..85885 + 378 WP_001603496.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N5859_RS23040 (N5859_22950) 86019..87203 - 1185 WP_284632849.1 DNA primase -
N5859_RS23045 (N5859_22955) 87291..88631 - 1341 WP_097296309.1 DnaB-like helicase C-terminal domain-containing protein -
N5859_RS23050 (N5859_22960) 88692..89417 - 726 WP_284632850.1 hypothetical protein -
N5859_RS23055 (N5859_22965) 89700..90467 + 768 WP_001711193.1 hypothetical protein -
N5859_RS23060 (N5859_22970) 90520..90873 - 354 WP_161953766.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / blaNDM-1 / sul2 / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / mph(A) / aph(3')-Ia htpB 1..133317 133317


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-119)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13477.24 Da        Isoelectric Point: 6.2257

>T258643 WP_001603496.1 NZ_CP104619:85508-85885 [Escherichia coli]
MRHISPEELIAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8190.24 Da        Isoelectric Point: 6.3159

>AT258643 WP_001603498.1 NZ_CP104619:85287-85508 [Escherichia coli]
MQSINFRTARSNLTEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDTTNKKLVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB L4J396

Antitoxin

Source ID Structure
AlphaFold DB L4J1C0

References