Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 4017813..4018520 Replicon chromosome
Accession NZ_CP104618
Organism Escherichia coli strain AHM9C68I

Toxin (Protein)


Gene name ykfI Uniprot ID A0A377AQ31
Locus tag N5859_RS19660 Protein ID WP_032161355.1
Coordinates 4017813..4018154 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag N5859_RS19665 Protein ID WP_032161354.1
Coordinates 4018185..4018520 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5859_RS19630 (4013792) 4013792..4014442 - 651 WP_001037977.1 HNH endonuclease -
N5859_RS19635 (4014579) 4014579..4014722 + 144 Protein_3840 HNH endonuclease -
N5859_RS19640 (4015356) 4015356..4016144 - 789 WP_032161357.1 helix-turn-helix domain-containing protein -
N5859_RS19645 (4016261) 4016261..4016536 - 276 WP_001683517.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5859_RS19650 (4016540) 4016540..4016788 - 249 WP_024187601.1 ribbon-helix-helix domain-containing protein -
N5859_RS19655 (4016865) 4016865..4017698 - 834 WP_032250394.1 DUF4942 domain-containing protein -
N5859_RS19660 (4017813) 4017813..4018154 - 342 WP_032161355.1 TA system toxin CbtA family protein Toxin
N5859_RS19665 (4018185) 4018185..4018520 - 336 WP_032161354.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5859_RS19670 (4018520) 4018520..4018993 - 474 WP_032161353.1 DNA repair protein RadC -
N5859_RS19675 (4019023) 4019023..4019841 - 819 WP_001683514.1 DUF932 domain-containing protein -
N5859_RS19680 (4020077) 4020077..4020556 - 480 WP_239594486.1 hypothetical protein -
N5859_RS19690 (4021349) 4021349..4021801 + 453 WP_152925145.1 hypothetical protein -
N5859_RS19695 (4022025) 4022025..4023005 - 981 WP_000019450.1 IS5-like element ISKpn26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimE / fimB 4007765..4023623 15858
- flank IS/Tn - - 4022025..4023005 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-110)

Antitoxin

Antitoxin CbeA

(10-110)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13048.01 Da        Isoelectric Point: 9.8953

>T258641 WP_032161355.1 NZ_CP104618:c4018154-4017813 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLTRLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRSHNTTAR

Download         Length: 342 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12530.56 Da        Isoelectric Point: 8.1281

>AT258641 WP_032161354.1 NZ_CP104618:c4018520-4018185 [Escherichia coli]
MLQKDKVMQQEWGLPCTVTPRFTARLVQERHNLHYLADRAAITGKFSSPDLLHIDQAFPVLMKQLELKLADGELSACQKR
TVTLYAKGLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377AQ31

Antitoxin

Source ID Structure

References