Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3672196..3672983 Replicon chromosome
Accession NZ_CP104618
Organism Escherichia coli strain AHM9C68I

Toxin (Protein)


Gene name yeeV Uniprot ID A0A377E3D6
Locus tag N5859_RS17990 Protein ID WP_001194695.1
Coordinates 3672606..3672983 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2H9G3E7
Locus tag N5859_RS17985 Protein ID WP_000066236.1
Coordinates 3672196..3672555 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5859_RS17940 (3667436) 3667436..3667888 + 453 WP_001020418.1 hypothetical protein -
N5859_RS17945 (3667885) 3667885..3668337 + 453 WP_000734138.1 hypothetical protein -
N5859_RS17950 (3668400) 3668400..3668942 + 543 WP_001104018.1 DUF4339 domain-containing protein -
N5859_RS17955 (3669002) 3669002..3669454 + 453 WP_001061894.1 IrmA family protein -
N5859_RS17960 (3669531) 3669531..3669764 + 234 WP_001114682.1 DUF905 domain-containing protein -
N5859_RS17965 (3669884) 3669884..3670702 + 819 WP_124846291.1 DUF932 domain-containing protein -
N5859_RS17970 (3670970) 3670970..3671439 + 470 Protein_3517 antirestriction protein -
N5859_RS17975 (3671451) 3671451..3671930 + 480 WP_000437750.1 DNA repair protein RadC -
N5859_RS17980 (3671951) 3671951..3672172 + 222 WP_000691981.1 DUF987 domain-containing protein -
N5859_RS17985 (3672196) 3672196..3672555 + 360 WP_000066236.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5859_RS17990 (3672606) 3672606..3672983 + 378 WP_001194695.1 TA system toxin CbtA family protein Toxin
N5859_RS17995 (3672980) 3672980..3673471 + 492 WP_000777682.1 DUF5983 family protein -
N5859_RS18000 (3673503) 3673503..3673706 + 204 WP_000413747.1 DUF957 domain-containing protein -
N5859_RS18005 (3673787) 3673787..3674631 + 845 Protein_3524 DUF4942 domain-containing protein -
N5859_RS18015 (3674973) 3674973..3675704 - 732 WP_001340895.1 DNA polymerase III subunit epsilon -
N5859_RS18020 (3675769) 3675769..3676236 + 468 WP_000917883.1 ribonuclease HI -
N5859_RS18025 (3676233) 3676233..3676955 - 723 WP_001326702.1 class I SAM-dependent methyltransferase -
N5859_RS18030 (3676989) 3676989..3677744 + 756 WP_001052715.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14180.97 Da        Isoelectric Point: 7.4209

>T258640 WP_001194695.1 NZ_CP104618:3672606-3672983 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13127.02 Da        Isoelectric Point: 7.0261

>AT258640 WP_000066236.1 NZ_CP104618:3672196-3672555 [Escherichia coli]
MSNKIPTVNHDITEPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377E3D6

Antitoxin

Source ID Structure
AlphaFold DB A0A2H9G3E7

References