Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3388334..3388952 | Replicon | chromosome |
Accession | NZ_CP104618 | ||
Organism | Escherichia coli strain AHM9C68I |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N5859_RS16550 | Protein ID | WP_001291435.1 |
Coordinates | 3388734..3388952 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N5859_RS16545 | Protein ID | WP_000344800.1 |
Coordinates | 3388334..3388708 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5859_RS16535 (3383423) | 3383423..3384616 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N5859_RS16540 (3384639) | 3384639..3387788 | + | 3150 | WP_284632658.1 | efflux RND transporter permease AcrB | - |
N5859_RS16545 (3388334) | 3388334..3388708 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N5859_RS16550 (3388734) | 3388734..3388952 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N5859_RS16555 (3389124) | 3389124..3389675 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N5859_RS16560 (3389791) | 3389791..3390261 | + | 471 | WP_000136192.1 | YlaC family protein | - |
N5859_RS16565 (3390425) | 3390425..3391975 | + | 1551 | WP_023281027.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N5859_RS16570 (3392017) | 3392017..3392370 | - | 354 | WP_124846190.1 | DUF1428 domain-containing protein | - |
N5859_RS16580 (3392749) | 3392749..3393060 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N5859_RS16585 (3393091) | 3393091..3393663 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258637 WP_001291435.1 NZ_CP104618:3388734-3388952 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258637 WP_000344800.1 NZ_CP104618:3388334-3388708 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |