Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2401761..2402399 | Replicon | chromosome |
Accession | NZ_CP104618 | ||
Organism | Escherichia coli strain AHM9C68I |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N5859_RS11705 | Protein ID | WP_000813794.1 |
Coordinates | 2402223..2402399 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5859_RS11700 | Protein ID | WP_105966292.1 |
Coordinates | 2401761..2402177 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5859_RS11680 (2396913) | 2396913..2397854 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
N5859_RS11685 (2397855) | 2397855..2398868 | - | 1014 | WP_000220393.1 | ABC transporter ATP-binding protein | - |
N5859_RS11690 (2398886) | 2398886..2400031 | - | 1146 | WP_124846286.1 | ABC transporter substrate-binding protein | - |
N5859_RS11695 (2400276) | 2400276..2401682 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N5859_RS11700 (2401761) | 2401761..2402177 | - | 417 | WP_105966292.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N5859_RS11705 (2402223) | 2402223..2402399 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N5859_RS11710 (2402621) | 2402621..2402851 | + | 231 | WP_000494244.1 | YncJ family protein | - |
N5859_RS11715 (2402943) | 2402943..2404904 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N5859_RS11720 (2404977) | 2404977..2405513 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N5859_RS11725 (2405605) | 2405605..2406780 | + | 1176 | WP_032253412.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258636 WP_000813794.1 NZ_CP104618:c2402399-2402223 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15228.60 Da Isoelectric Point: 4.7386
>AT258636 WP_105966292.1 NZ_CP104618:c2402177-2401761 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVIV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVIV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|