Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 979496..980079 | Replicon | chromosome |
Accession | NZ_CP104618 | ||
Organism | Escherichia coli strain AHM9C68I |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N5859_RS04760 | Protein ID | WP_000254738.1 |
Coordinates | 979744..980079 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1V2T5M9 |
Locus tag | N5859_RS04755 | Protein ID | WP_000581941.1 |
Coordinates | 979496..979744 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5859_RS04745 (975835) | 975835..977136 | + | 1302 | WP_023281448.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N5859_RS04750 (977184) | 977184..979418 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N5859_RS04755 (979496) | 979496..979744 | + | 249 | WP_000581941.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N5859_RS04760 (979744) | 979744..980079 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N5859_RS04765 (980150) | 980150..980941 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N5859_RS04770 (981169) | 981169..982806 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N5859_RS04775 (982894) | 982894..984192 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T258629 WP_000254738.1 NZ_CP104618:979744-980079 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|