Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 62950..63472 Replicon plasmid pHNAH8212R
Accession NZ_CP104615
Organism Escherichia coli strain AHM8C212RI

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag N5856_RS24680 Protein ID WP_000220561.1
Coordinates 62950..63231 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag N5856_RS24685 Protein ID WP_000121743.1
Coordinates 63221..63472 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5856_RS24650 (N5856_24580) 58426..58662 - 237 Protein_61 hypothetical protein -
N5856_RS24655 (N5856_24585) 58683..59477 - 795 WP_000572405.1 aminoglycoside O-phosphotransferase APH(3')-IIa -
N5856_RS24660 (N5856_24590) 59506..60936 - 1431 Protein_63 IS4-like element IS50R family transposase -
N5856_RS24665 (N5856_24595) 61056..61244 + 189 WP_000957857.1 hypothetical protein -
N5856_RS24670 (N5856_24600) 61254..62453 + 1200 WP_000948429.1 IS91 family transposase -
N5856_RS24675 (N5856_24605) 62619..62711 + 93 Protein_66 IS6 family transposase -
N5856_RS24680 (N5856_24610) 62950..63231 - 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5856_RS24685 (N5856_24615) 63221..63472 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
N5856_RS24690 (N5856_24620) 64663..65502 + 840 WP_024129959.1 replication initiation protein -
N5856_RS24695 (N5856_24625) 65523..66365 + 843 WP_000435064.1 replication initiation protein -
N5856_RS24700 (N5856_24630) 66369..66815 + 447 WP_001074384.1 hypothetical protein -
N5856_RS24705 (N5856_24635) 66952..67305 + 354 WP_024129958.1 DNA distortion polypeptide 3 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / oqxA / oqxB / aph(3')-IIa / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / rmtB / blaTEM-1B - 1..95335 95335


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T258624 WP_000220561.1 NZ_CP104615:c63231-62950 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT258624 WP_000121743.1 NZ_CP104615:c63472-63221 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References