Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 34249..34892 | Replicon | plasmid pHNAH8212R |
Accession | NZ_CP104615 | ||
Organism | Escherichia coli strain AHM8C212RI |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | N5856_RS24545 | Protein ID | WP_001044768.1 |
Coordinates | 34476..34892 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | N5856_RS24540 | Protein ID | WP_001261287.1 |
Coordinates | 34249..34479 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5856_RS24515 (N5856_24445) | 30699..31721 | + | 1023 | WP_000255944.1 | IS21-like element IS100 family transposase | - |
N5856_RS24520 (N5856_24450) | 31718..32500 | + | 783 | WP_001300609.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
N5856_RS24525 (N5856_24455) | 32539..32724 | + | 186 | WP_284632464.1 | hypothetical protein | - |
N5856_RS24530 (N5856_24460) | 32774..33673 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
N5856_RS24535 (N5856_24465) | 33663..33953 | - | 291 | WP_000111771.1 | hypothetical protein | - |
N5856_RS24540 (N5856_24470) | 34249..34479 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N5856_RS24545 (N5856_24475) | 34476..34892 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5856_RS24550 (N5856_24480) | 35054..37192 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
N5856_RS24555 (N5856_24485) | 37546..37803 | + | 258 | WP_000343085.1 | hypothetical protein | - |
N5856_RS24560 (N5856_24490) | 37803..38393 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / oqxA / oqxB / aph(3')-IIa / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / rmtB / blaTEM-1B | - | 1..95335 | 95335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T258623 WP_001044768.1 NZ_CP104615:34476-34892 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |