Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 4301988..4302742 | Replicon | chromosome |
Accession | NZ_CP104613 | ||
Organism | Escherichia coli strain AHM8C212RI |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | N5856_RS20820 | Protein ID | WP_094317974.1 |
Coordinates | 4302257..4302742 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q8X700 |
Locus tag | N5856_RS20815 | Protein ID | WP_000801912.1 |
Coordinates | 4301988..4302266 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5856_RS20810 (4299216) | 4299216..4301921 | + | 2706 | WP_023486406.1 | HTH-type transcriptional regulator MalT | - |
N5856_RS20815 (4301988) | 4301988..4302266 | + | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
N5856_RS20820 (4302257) | 4302257..4302742 | + | 486 | WP_094317974.1 | GNAT family N-acetyltransferase | Toxin |
N5856_RS20825 (4302792) | 4302792..4303820 | - | 1029 | WP_094317992.1 | RNA 3'-terminal phosphate cyclase | - |
N5856_RS20830 (4303824) | 4303824..4305050 | - | 1227 | WP_094317975.1 | RNA-splicing ligase RtcB | - |
N5856_RS20835 (4305237) | 4305237..4306835 | + | 1599 | WP_001232937.1 | DNA-binding transcriptional regulator RtcR | - |
N5856_RS20840 (4306817) | 4306817..4307575 | - | 759 | WP_000815099.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17708.61 Da Isoelectric Point: 9.1189
>T258617 WP_094317974.1 NZ_CP104613:4302257-4302742 [Escherichia coli]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLEIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLEIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|