Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3913789..3914586 | Replicon | chromosome |
Accession | NZ_CP104613 | ||
Organism | Escherichia coli strain AHM8C212RI |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A346GMF9 |
Locus tag | N5856_RS18895 | Protein ID | WP_072644276.1 |
Coordinates | 3913789..3914166 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A346GRC6 |
Locus tag | N5856_RS18900 | Protein ID | WP_072648994.1 |
Coordinates | 3914212..3914586 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5856_RS18865 (3910202) | 3910202..3911530 | - | 1329 | WP_024250060.1 | IS4-like element IS4 family transposase | - |
N5856_RS18870 (3911635) | 3911635..3912141 | - | 507 | WP_000228930.1 | G/U mismatch-specific DNA glycosylase | - |
N5856_RS18880 (3912428) | 3912428..3913273 | - | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
N5856_RS18885 (3913370) | 3913370..3913567 | - | 198 | WP_094770706.1 | DUF957 domain-containing protein | - |
N5856_RS18890 (3913643) | 3913643..3913792 | - | 150 | Protein_3691 | DUF5983 family protein | - |
N5856_RS18895 (3913789) | 3913789..3914166 | - | 378 | WP_072644276.1 | TA system toxin CbtA family protein | Toxin |
N5856_RS18900 (3914212) | 3914212..3914586 | - | 375 | WP_072648994.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N5856_RS18905 (3914665) | 3914665..3914886 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
N5856_RS18910 (3914955) | 3914955..3915431 | - | 477 | WP_071045793.1 | RadC family protein | - |
N5856_RS18915 (3915447) | 3915447..3915932 | - | 486 | WP_072815258.1 | antirestriction protein | - |
N5856_RS18920 (3916023) | 3916023..3916841 | - | 819 | WP_250308369.1 | DUF932 domain-containing protein | - |
N5856_RS18925 (3916932) | 3916932..3917165 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3910202..3911530 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14231.23 Da Isoelectric Point: 7.7761
>T258615 WP_072644276.1 NZ_CP104613:c3914166-3913789 [Escherichia coli]
MKTLPDTYVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNDITQGKHPEVKR
MKTLPDTYVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNDITQGKHPEVKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13869.65 Da Isoelectric Point: 6.2043
>AT258615 WP_072648994.1 NZ_CP104613:c3914586-3914212 [Escherichia coli]
VSDKLHETNYPDDHNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDKLHETNYPDDHNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A346GMF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A346GRC6 |