Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3787908..3788743 | Replicon | chromosome |
| Accession | NZ_CP104613 | ||
| Organism | Escherichia coli strain AHM8C212RI | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1EZ92 |
| Locus tag | N5856_RS18290 | Protein ID | WP_000854726.1 |
| Coordinates | 3788366..3788743 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N5856_RS18285 | Protein ID | WP_064226358.1 |
| Coordinates | 3787908..3788276 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5856_RS18260 (3783381) | 3783381..3786227 | + | 2847 | WP_284632327.1 | Ag43/Cah family autotransporter adhesin | - |
| N5856_RS18265 (3786554) | 3786554..3786877 | + | 324 | Protein_3567 | DUF932 domain-containing protein | - |
| N5856_RS18270 (3786854) | 3786854..3787048 | + | 195 | Protein_3568 | antirestriction protein | - |
| N5856_RS18275 (3787063) | 3787063..3787539 | + | 477 | WP_064226357.1 | RadC family protein | - |
| N5856_RS18280 (3787608) | 3787608..3787829 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| N5856_RS18285 (3787908) | 3787908..3788276 | + | 369 | WP_064226358.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5856_RS18290 (3788366) | 3788366..3788743 | + | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
| N5856_RS18295 (3788740) | 3788740..3789228 | + | 489 | WP_063100845.1 | DUF5983 family protein | - |
| N5856_RS18300 (3789240) | 3789240..3789437 | + | 198 | WP_000839269.1 | DUF957 domain-containing protein | - |
| N5856_RS18305 (3789522) | 3789522..3790364 | + | 843 | WP_077737641.1 | DUF4942 domain-containing protein | - |
| N5856_RS18310 (3790646) | 3790646..3791182 | - | 537 | WP_038339826.1 | GspM family type II secretion system protein YghD | - |
| N5856_RS18315 (3791184) | 3791184..3792362 | - | 1179 | WP_071337510.1 | type II secretion system protein GspL | - |
| N5856_RS18320 (3792359) | 3792359..3793336 | - | 978 | WP_094318014.1 | type II secretion system minor pseudopilin GspK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T258614 WP_000854726.1 NZ_CP104613:3788366-3788743 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.36 Da Isoelectric Point: 6.4761
>AT258614 WP_064226358.1 NZ_CP104613:3787908-3788276 [Escherichia coli]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPHHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPHHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|