Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3641046..3641700 | Replicon | chromosome |
Accession | NZ_CP104613 | ||
Organism | Escherichia coli strain AHM8C212RI |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N5856_RS17570 | Protein ID | WP_000244781.1 |
Coordinates | 3641046..3641453 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N5856_RS17575 | Protein ID | WP_000354046.1 |
Coordinates | 3641434..3641700 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5856_RS17550 (3637003) | 3637003..3638736 | - | 1734 | WP_094318021.1 | single-stranded-DNA-specific exonuclease RecJ | - |
N5856_RS17555 (3638742) | 3638742..3639452 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5856_RS17560 (3639477) | 3639477..3640373 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N5856_RS17565 (3640485) | 3640485..3641006 | + | 522 | WP_001613762.1 | flavodoxin FldB | - |
N5856_RS17570 (3641046) | 3641046..3641453 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
N5856_RS17575 (3641434) | 3641434..3641700 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N5856_RS17580 (3641943) | 3641943..3642923 | + | 981 | WP_001613766.1 | tRNA-modifying protein YgfZ | - |
N5856_RS17585 (3643000) | 3643000..3643659 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
N5856_RS17590 (3643823) | 3643823..3644134 | - | 312 | WP_250308304.1 | N(4)-acetylcytidine aminohydrolase | - |
N5856_RS17595 (3644179) | 3644179..3645612 | + | 1434 | WP_024250004.1 | 6-phospho-beta-glucosidase BglA | - |
N5856_RS17600 (3645669) | 3645669..3646412 | - | 744 | WP_085008381.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258613 WP_000244781.1 NZ_CP104613:c3641453-3641046 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|