Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3520385..3520968 | Replicon | chromosome |
Accession | NZ_CP104613 | ||
Organism | Escherichia coli strain AHM8C212RI |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N5856_RS17065 | Protein ID | WP_000254738.1 |
Coordinates | 3520385..3520720 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N5856_RS17070 | Protein ID | WP_000581937.1 |
Coordinates | 3520720..3520968 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5856_RS17050 (3516271) | 3516271..3517569 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
N5856_RS17055 (3517657) | 3517657..3519294 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N5856_RS17060 (3519522) | 3519522..3520313 | - | 792 | WP_001071673.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N5856_RS17065 (3520385) | 3520385..3520720 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N5856_RS17070 (3520720) | 3520720..3520968 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N5856_RS17075 (3521046) | 3521046..3523280 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N5856_RS17080 (3523328) | 3523328..3524629 | - | 1302 | WP_000046800.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T258612 WP_000254738.1 NZ_CP104613:c3520720-3520385 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|