Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3227378..3228003 | Replicon | chromosome |
| Accession | NZ_CP104613 | ||
| Organism | Escherichia coli strain AHM8C212RI | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5856_RS15625 | Protein ID | WP_000911330.1 |
| Coordinates | 3227378..3227776 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | N5856_RS15630 | Protein ID | WP_000450524.1 |
| Coordinates | 3227776..3228003 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5856_RS15605 (3223256) | 3223256..3223456 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| N5856_RS15610 (3223566) | 3223566..3224264 | - | 699 | WP_000679823.1 | esterase | - |
| N5856_RS15615 (3224338) | 3224338..3226353 | - | 2016 | WP_097702170.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| N5856_RS15620 (3226368) | 3226368..3227231 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| N5856_RS15625 (3227378) | 3227378..3227776 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5856_RS15630 (3227776) | 3227776..3228003 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N5856_RS15635 (3228157) | 3228157..3228870 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| N5856_RS15640 (3229083) | 3229083..3230117 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| N5856_RS15645 (3230134) | 3230134..3231012 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| N5856_RS15650 (3231158) | 3231158..3231730 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| N5856_RS15655 (3231730) | 3231730..3232200 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T258610 WP_000911330.1 NZ_CP104613:c3227776-3227378 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|