Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1708242..1709082 | Replicon | chromosome |
Accession | NZ_CP104613 | ||
Organism | Escherichia coli strain AHM8C212RI |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LJY4 |
Locus tag | N5856_RS08095 | Protein ID | WP_000854686.1 |
Coordinates | 1708699..1709082 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0YJ34 |
Locus tag | N5856_RS08090 | Protein ID | WP_001360163.1 |
Coordinates | 1708242..1708622 (+) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5856_RS08065 (1705358) | 1705358..1706176 | + | 819 | WP_001234732.1 | DUF932 domain-containing protein | - |
N5856_RS08070 (1706268) | 1706268..1706753 | + | 486 | WP_000214307.1 | antirestriction protein | - |
N5856_RS08075 (1706769) | 1706769..1707245 | + | 477 | WP_001186726.1 | RadC family protein | - |
N5856_RS08080 (1707308) | 1707308..1707529 | + | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
N5856_RS08085 (1707548) | 1707548..1708231 | + | 684 | WP_000086769.1 | hypothetical protein | - |
N5856_RS08090 (1708242) | 1708242..1708622 | + | 381 | WP_001360163.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N5856_RS08095 (1708699) | 1708699..1709082 | + | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
N5856_RS08100 (1709079) | 1709079..1709567 | + | 489 | WP_001054233.1 | DUF5983 family protein | - |
N5856_RS08105 (1709584) | 1709584..1709697 | + | 114 | Protein_1574 | DUF957 domain-containing protein | - |
N5856_RS08110 (1709695) | 1709695..1710183 | + | 489 | Protein_1575 | DUF4942 domain-containing protein | - |
N5856_RS08120 (1710654) | 1710654..1711592 | + | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
N5856_RS08125 (1711647) | 1711647..1712384 | + | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
N5856_RS08130 (1712408) | 1712408..1712962 | + | 555 | WP_001001917.1 | molecular chaperone YcdY | - |
N5856_RS08135 (1713064) | 1713064..1713555 | + | 492 | WP_001383029.1 | DUF1097 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T258603 WP_000854686.1 NZ_CP104613:1708699-1709082 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13950.74 Da Isoelectric Point: 5.0823
>AT258603 WP_001360163.1 NZ_CP104613:1708242-1708622 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCIVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCIVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|