Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 444057..444855 | Replicon | chromosome |
| Accession | NZ_CP104613 | ||
| Organism | Escherichia coli strain AHM8C212RI | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X1M0U2 |
| Locus tag | N5856_RS02140 | Protein ID | WP_000854919.1 |
| Coordinates | 444478..444855 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2G4AEZ5 |
| Locus tag | N5856_RS02135 | Protein ID | WP_001285608.1 |
| Coordinates | 444057..444431 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5856_RS02100 (439348) | 439348..440025 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| N5856_RS02105 (440031) | 440031..440264 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| N5856_RS02110 (440354) | 440354..441172 | + | 819 | WP_250308361.1 | DUF932 domain-containing protein | - |
| N5856_RS02120 (442699) | 442699..443178 | + | 480 | WP_250308362.1 | antirestriction protein | - |
| N5856_RS02125 (443193) | 443193..443669 | + | 477 | WP_001186188.1 | RadC family protein | - |
| N5856_RS02130 (443756) | 443756..443977 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| N5856_RS02135 (444057) | 444057..444431 | + | 375 | WP_001285608.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5856_RS02140 (444478) | 444478..444855 | + | 378 | WP_000854919.1 | TA system toxin CbtA family protein | Toxin |
| N5856_RS02145 (444852) | 444852..445340 | + | 489 | WP_250308363.1 | DUF5983 family protein | - |
| N5856_RS02150 (445360) | 445360..445557 | + | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| N5856_RS02155 (445642) | 445642..445785 | + | 144 | Protein_413 | hypothetical protein | - |
| N5856_RS02160 (446327) | 446327..447325 | + | 999 | WP_001240356.1 | membrane protein | - |
| N5856_RS02165 (447436) | 447436..448308 | - | 873 | WP_001600928.1 | HNH endonuclease | - |
| N5856_RS02170 (448408) | 448408..448512 | + | 105 | Protein_416 | HNH endonuclease | - |
| N5856_RS02175 (448520) | 448520..449500 | - | 981 | WP_000991444.1 | sialate O-acetylesterase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | papC / fimB / fimE | 417434..454535 | 37101 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.97 Da Isoelectric Point: 7.9086
>T258598 WP_000854919.1 NZ_CP104613:444478-444855 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13610.37 Da Isoelectric Point: 5.5051
>AT258598 WP_001285608.1 NZ_CP104613:444057-444431 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X1M0U2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4AEZ5 |